Tap / click on image to see more RealViewsTM
$13.35
$4.45 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue

Customer Reviews

4.8 out of 5 stars rating2.8K Total Reviews
2508 total 5-star reviews146 total 4-star reviews44 total 3-star reviews22 total 2-star reviews40 total 1-star reviews
2,760 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.2 September 2025Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Love it , quality is great and designs beautiful. Its a shame the sizing and prices changed but won't stop me buying more haha.
5 out of 5 stars rating
By Wendy C.10 June 2025Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
So pleased I finally got my order, 1st one went missing in the post. But I Absolutely adore this paper, so whimsical ❤️ thanks it’s so beautiful! .
5 out of 5 stars rating
By DM S.19 June 2022Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
It looks stunning on my bedside dresser door. Very bold and colourful

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Posted on 18/01/2022, 8:27 PM
Rating: G