Sell on Zazzle
Tap / click on image to see more RealViewsTM
$4.90
per sticker
 

Alaska Highway Canada - Alaska USA 01 Sticker

4.6 out of 5 stars rating
1081 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Alaska Highway Canada - Alaska USA 01 Sticker

Alaska Highway Canada - Alaska USA 01 Sticker

The Alaska Highway (also known as the Alaskan Highway, Alaska-Canadian Highway, or ALCAN Highway) was constructed during World War II to connect the contiguous United States to Alaska across Canada. It begins at the junction with several Canadian highways in Dawson Creek, British Columbia, and runs to Delta Junction, Alaska, via Whitehorse, Yukon. When it was completed in 1942 it was about 2,700 kilometres (1,700 mi); but in 2012 it was only 2,232 km (1,387 mi). This is due to constant reconstruction of the highway, which has rerouted and straightened many sections. Once legendary for being a rough, challenging drive, the highway is now paved over its entire length. Its component highways are British Columbia Highway 97, Yukon Highway 1 and Alaska Route 2.
OuterShellUK
Artwork designed by
United Kingdom
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
892 total 5-star reviews68 total 4-star reviews27 total 3-star reviews22 total 2-star reviews72 total 1-star reviews
1,081 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker
5 out of 5 stars rating
By D.16 August 2023 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.

Tags

Custom-Cut Vinyl Stickers
motorcyclemotorcycle road tripsturgisalaska highwayalaskan highwayalcanalaskacanadatravelpannier sticker
All Products
motorcyclemotorcycle road tripsturgisalaska highwayalaskan highwayalcanalaskacanadatravelpannier sticker

Other Info

Product ID: 256829904580003487
Posted on 13/02/2026, 7:27 AM
Rating: G