Tap / click on image to see more RealViewsTM
Sale Price $3.30.  
Original Price $4.40 per card
You save 25%

Baby Girl Shower Invitation Coquette Bow Aesthetic

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.90
+$0.90
-$0.30

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple paper types, shapes and sizes to design a card that's perfect for you.

  • Dimensions: 12.7 x 17.8 cm (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Various curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 x 17.8 cm. For best results please add 0.16 cm bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Baby Girl Shower Invitation Coquette Bow Aesthetic

Baby Girl Shower Invitation Coquette Bow Aesthetic

Celebrate your little one in style with this coquette-inspired baby shower invitation featuring soft shades of pink, a delicate lined background, and a charming bow design for that timeless feminine touch. Perfect for moms-to-be who love the romantic coquette aesthetic, this invitation blends elegance, sweetness, and modern charm. Whether you’re planning a classic pink baby shower, a girly tea party theme, or a stylish bow-inspired celebration, this design sets the tone for a beautiful gathering. The blush tones and dainty details make it a versatile choice for baby girls, while the pretty bow motif adds a touch of vintage-inspired grace.

Customer Reviews

4.8 out of 5 stars rating11.2K Total Reviews
10029 total 5-star reviews800 total 4-star reviews143 total 3-star reviews66 total 2-star reviews133 total 1-star reviews
11,171 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.1 June 2016Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
It took me a little practice to get used to using the customization tools, so I got some kind emails describing how to fix the problems. But once I got it figured out, it was simple and I was grateful for the quick service and turn-around. The card stock is nice, and the design is so cute I couldn't resist. It's perfect for what I needed. No issues with the printing, the colors seem to be right on. I think the card may have been cut slightly off-center, but hard to know because it may have also been my error in customizing the text.
5 out of 5 stars rating
By Deborah B.9 July 2019Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
The card was great. I love ability to include information on back and that there is a follow through from front of card. The card stock was just as described. Colors of gold, pink and accents were great. The color showed up perfectly on the card. Nothing was overpowering. The pineapple graphic made it perfect of my Hawaiian theme
from zazzle.com (US)
5 out of 5 stars rating
By JoLynn L.10 August 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Loved the ease of ordering and prices. These were exactly what my daughter wanted. The order came quickly and were amazing quality. The entire theme came together from this inspiration.
from zazzle.com (US)

Tags

Invitations
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage
All Products
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage

Other Info

Product ID: 256478287450966463
Posted on 22/09/2025, 11:55 AM
Rating: G