Tap / click on image to see more RealViewsTM
$78.40
per tie
 

Birds of Patagonia Birds Wildlife Animals Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Birds of Patagonia Birds Wildlife Animals Tie

Birds of Patagonia Birds Wildlife Animals Tie

Gorgeous collage of vintage fine art of some of the Birds of Patagonia on this Tie. Images are public domain due to expired copyright.

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1789 total 5-star reviews323 total 4-star reviews136 total 3-star reviews67 total 2-star reviews102 total 1-star reviews
2,417 Reviews
Reviews for similar products
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Product was of good quality. The fabric is excellent
5 out of 5 stars rating
By Janette C.28 February 2016Verified Purchase
Tie
Zazzle Reviewer Program
Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Item is of very good quality. The fabric is excellent

Tags

Ties
birdanimalwildlifetienecktiepatagoniawetlandsflamingoesduckspatagonia wildlife
All Products
birdanimalwildlifetienecktiepatagoniawetlandsflamingoesduckspatagonia wildlife

Other Info

Product ID: 151130513312386564
Posted on 31/12/2018, 8:02 AM
Rating: G