Tap / click on image to see more RealViewsTM
$15.70
per sticker
 

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Oval and Die Cut Vinyl Stickers. Stick these black bear vinyl decals to your laptop, phone, notebook, water bottle, bicycle helmet, skateboard, guitar case or even your car. These durable wildlife stickers are waterproof and fade proof. A cool design for explorers who enjoy hiking, camping, and travelling to national parks. Available in assorted sizes up to 14” wide. Visit Jenn's Doodle World for even more nature stickers and animal silhouette stickers and accessories.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
904 total 5-star reviews68 total 4-star reviews27 total 3-star reviews27 total 2-star reviews80 total 1-star reviews
1,106 Reviews
5 out of 5 stars rating
By Barbara D.15 July 2020Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Sticks really well on licence plate. Print turned out really cute.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker

Tags

Custom-Cut Vinyl Stickers
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks
All Products
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks

Other Info

Product ID: 256980266642531566
Posted on 22/03/2019, 10:17 PM
Rating: G