Tap / click on image to see more RealViewsTM
Sale Price $3.26.  
Original Price $4.65 per card
You save 30%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$2.40
+$1.00
+$1.00
-$0.30
+$1.00

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colours to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating32.4K Total Reviews
28487 total 5-star reviews2870 total 4-star reviews500 total 3-star reviews230 total 2-star reviews292 total 1-star reviews
32,379 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.6 October 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Absolutely amazing! Exactly what i was looking for. Turned out better colourwise then i expected so im insanely happy!
5 out of 5 stars rating
By A.26 February 2023Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Loved the details, paper, fonts, colours. Very happy with colours and detail
5 out of 5 stars rating
By Erica V.19 July 2024Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Love these. I wish I had thought to add a section for writing the person the invitation is addressed to but beautiful design. . Great print and perfect for our beach theme.

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Posted on 27/09/2024, 8:23 AM
Rating: G