Tap / click on image to see more RealViewsTM
$89.75
per wallpaper
 

Blue Dog Kisses Wallpaper

by
Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Smooth Vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Blue Dog Kisses  Wallpaper

Blue Dog Kisses Wallpaper

Style: Smooth Vinyl Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers. Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas. Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition. Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colours to suit your personal style and enhance the ambiance of any room. DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money. Need some guidance on hanging your wallpaper? Please check out our how-to guide here

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Wallpapers
weddingbridal showerbirthdayhousewarmingkidsfamilywallpaperwall coveringhome decorfamily room
All Products
weddingbridal showerbirthdayhousewarmingkidsfamilywallpaperwall coveringhome decorfamily room

Other Info

Product ID: 256883716273603671
Posted on 30/06/2025, 9:06 PM
Rating: G