Tap / click on image to see more RealViewsTM
$9.45
per sticker
 

Blue Tile Mediterranean with Lemons Bridal Shower

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Blue Tile Mediterranean with Lemons Bridal Shower

Blue Tile Mediterranean with Lemons Bridal Shower

Celebrate the bride-to-be in refreshing Mediterranean style with the Blue Tile Mediterranean with Lemons Bridal Shower "She Found Her Main Squeeze" Sticker. Featuring elegant blue tile patterns paired with bright lemons and a charming citrus theme, this invitation is perfect for bridal showers, brunches, garden parties, or summer celebrations honouring the future bride. This is a fully editable template, allowing you to easily customise text, colours, and event details to match your celebration. No design experience required. Designed for both print and digital use, the template gives you flexible options for sharing or printing your invitation.

Customer Reviews

1.0 out of 5 stars rating1 Total Reviews
0 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
1 Reviews
Reviews for similar products
1.0 out of 5 stars rating
1 out of 5 stars rating
By Cathy P.24 March 2026Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
The stickers were way too tiny.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
bacheloretteweekendinvitationbridalpartybridalweekenditinerarytemplateprintablebacheloretteinvitationlemonbridalshowerinvitationmediterraneanbridalinviteshefoundhermainsqueezebluetilebridalshowerbridallemonshowersticker
All Products
bacheloretteweekendinvitationbridalpartybridalweekenditinerarytemplateprintablebacheloretteinvitationlemonbridalshowerinvitationmediterraneanbridalinviteshefoundhermainsqueezebluetilebridalshowerbridallemonshowersticker

Other Info

Product ID: 256911995831173427
Posted on 22/06/2026, 11:52 AM
Rating: G