Tap / click on image to see more RealViewsTM
$30.90
$5.15 per sheet of tissue paper
 

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Wrap your gifts with understated elegance using our BlushVine Tissue Paper. Featuring a seamless pattern of stylised leaves outlined in soft pink on a crisp white background, this design offers a clean, modern aesthetic with botanical charm. Perfect for weddings, baby showers, boutique packaging, or everyday gifting, the delicate leaf motif adds a refined touch to any presentation. Lightweight, versatile, and visually soothing—this tissue paper elevates your wrapping game with graceful simplicity.

Customer Reviews

4.8 out of 5 stars rating3K Total Reviews
2690 total 5-star reviews159 total 4-star reviews51 total 3-star reviews26 total 2-star reviews57 total 1-star reviews
2,983 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.2 September 2025Verified Purchase
Custom 26.6 g/m² Tissue, Size: 53.34 cm x 73.66 cm
Love it , quality is great and designs beautiful. Its a shame the sizing and prices changed but won't stop me buying more haha.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy C.10 June 2025Verified Purchase
Custom 14.8 g/m² Tissue, Size: 45.72 cm x 60.96 cm
So pleased I finally got my order, 1st one went missing in the post. But I Absolutely adore this paper, so whimsical ❤️ thanks it’s so beautiful! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By DM S.9 April 2023Verified Purchase
Custom 26.6 g/m² Tissue, Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
beautiful paper i used this on my sons dressing table and vintaged the edges using patina paint. he loves it. just perfect i love the colors in this picture

Tags

Tissue Paper
blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign
All Products
blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign

Other Info

Product ID: 256347280109911345
Posted on 13/08/2024, 3:47 AM
Rating: G