Tap / click on image to see more RealViewsTM
Sale Price $4.73.  
Original Price $6.30 per card
You save 25%

Caduceus

Qty:
Squared
Basic Semi-Gloss
16 pt thickness / 150 lb weight Bright white, smooth texture

About Flat Cards

Sold by

Size: 10.2 cm x 22.9 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 10.2 cm x 22.9 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Basic Semi-Gloss

Bright, smooth, and polished—our Basic Semi-Gloss paper brings your design to life with vibrant colour and a subtle shine. It’s the perfect choice for everyday elegance and budget-friendly celebrations.

About This Design

Caduceus

Caduceus

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.3K Total Reviews
2032 total 5-star reviews156 total 4-star reviews40 total 3-star reviews28 total 2-star reviews78 total 1-star reviews
2,334 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous29 December 2024Verified Purchase
Flat Card, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
My daughter loved the boarding pass surprise and it was so easy to do and was delivered quickly and in time for her 30th birthday .. it was such a neat way of telling her of her trip .. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sally R.19 September 2021Verified Purchase
Flat Card, Size: 20.3 cm x 10.2 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
Probably the most meaningful card I’ve brought would definitely buy it again for other occasions. Printing was amazing
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tania W.25 May 2021Verified Purchase
Zazzle Reviewer Program
Love it. Highly recommend. A novel way of expressing condolences. Printing was perfect.

Tags

Flat Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 245343749875724602
Posted on 25/04/2010, 1:54 PM
Rating: G