Tap / click on image to see more RealViewsTM
Sale Price $35.28.  
Original Price $44.10 per pack of 50
You save 20%

Caduceus Business Card

Qty:
  1. Size

  2. Corner Style

  3. Paper

Other designs from this category

About Business Cards

Sold by

Size: 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm × 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating40.5K Total Reviews
33496 total 5-star reviews3891 total 4-star reviews1109 total 3-star reviews741 total 2-star reviews1281 total 1-star reviews
40,518 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By name7 April 2015Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous4 February 2026Verified Purchase
Business Card, Size: 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Absolutely beautiful. Superior quality to Vistaprint, and the price made it very worth while. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Posted on 25/04/2010, 1:11 PM
Rating: G