Tap / click on image to see more RealViewsTM
$60.35
per pack of 100
 

Caduceus Business Card

Qty:
Squared
+$11.65
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$11.65
-$11.65
+$11.60
+$11.60

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating38.9K Total Reviews
32497 total 5-star reviews3813 total 4-star reviews1005 total 3-star reviews631 total 2-star reviews976 total 1-star reviews
38,922 Reviews
5 out of 5 stars rating
By n.7 April 2015Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Anonymous4 February 2026Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Absolutely beautiful. Superior quality to Vistaprint, and the price made it very worth while. .
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Posted on 25/04/2010, 1:11 PM
Rating: G