Tap / click on image to see more RealViewsTM
$15.65
per sheet of 20
 

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+$0.65
+$0.65
+$0.65

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating26.4K Total Reviews
22906 total 5-star reviews2169 total 4-star reviews528 total 3-star reviews310 total 2-star reviews466 total 1-star reviews
26,379 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lisa T.23 November 2020Verified Purchase
Zazzle Reviewer Program
Stickers had a glossy finish which gave them a very professional look. The colour is perfect. And they are the exact size of my lip balm lids. Printing is crisp and clear. Will definitely be ordering again.
5 out of 5 stars rating
By Debbie O.18 February 2024Verified Purchase
Zazzle Reviewer Program
The label is the perfect size , great quality as a label for a glass jar and the product was just as it looked on line and arrived within a very quick timeframe. The design was just perfect tasteful artistic and I have received so many comments from people on the label . A perfect size, colour and font very professional.
5 out of 5 stars rating
By Tahlia W.22 February 2021Verified Purchase
Zazzle Reviewer Program
This product was fantastic, it looked great, stuck well and was exactly what I had expected and more. The image and colours were perfect, they matched exactly what I had ordered!

Tags

Stickers
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217176518511647409
Posted on 26/04/2010, 7:47 AM
Rating: G