Tap / click on image to see more RealViewsTM
$20.10
per keychain
 

Caduceus Key Ring

Qty:
  1. Style

Other designs from this category

About Keychains

About This Design

Caduceus Key Ring

Caduceus Key Ring

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4235 total 5-star reviews784 total 4-star reviews218 total 3-star reviews118 total 2-star reviews104 total 1-star reviews
5,459 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Victoria21 August 2023Verified Purchase
Zazzle Reviewer Program
Beyond expectations. Choice of artwork is overwhelming, I found exactly what I needed from SJW_Graphics. Detail, colors, overall design looks great on this keyring. Could use as a pendant, purse charm, bookmark, too! Metal is sturdy without being heavy. Colors beautiful, with clear margins. Customized name makes this gift extra special. So many fonts, so many colors & sizes!
from zazzle.com (US)
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nico S.27 February 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
I find this very interesting and great since I am a huge fan of snakes. This keychain fits the bill!
from zazzle.com (US)

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146005941259371004
Posted on 25/04/2010, 1:43 PM
Rating: G