Tap / click on image to see more RealViewsTM
$20.10
per keychain
 

Caduceus Key Ring

Qty:
Aluminum Circle
+$5.25
+$5.25
+$25.70
+$25.70

Other designs from this category

About Keychains

About This Design

Caduceus Key Ring

Caduceus Key Ring

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4224 total 5-star reviews783 total 4-star reviews216 total 3-star reviews116 total 2-star reviews102 total 1-star reviews
5,441 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Christina J.11 March 2024Verified Purchase
Premium Round Keychain, Large (5.397 cm)
These are a durable metal and the colors are vibrant. One of the clasp came broken but received a new one quickly. Customer service was responsive and quick to resolve the issue. They are bigger than I thought but still work for my wedding. I am satisfied with the print quality and surprised at how vibrant the colors are.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By V.21 August 2023Verified Purchase
Zazzle Reviewer Program
Beyond expectations. Choice of artwork is overwhelming, I found exactly what I needed from SJW_Graphics. Detail, colors, overall design looks great on this keyring. Could use as a pendant, purse charm, bookmark, too! Metal is sturdy without being heavy. Colors beautiful, with clear margins. Customized name makes this gift extra special. So many fonts, so many colors & sizes!
from zazzle.com (US)
Original product

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Posted on 25/04/2010, 1:42 PM
Rating: G