Tap / click on image to see more RealViewsTM
$3.35
per postcard
 

Caduceus Postcard

Qty:
  1. Paper Type

  2. Attribution

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H; qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Caduceus Postcard

Caduceus Postcard

Design that makes caduceus motif

Customer Reviews

4.9 out of 5 stars rating16K Total Reviews
14533 total 5-star reviews1016 total 4-star reviews213 total 3-star reviews85 total 2-star reviews147 total 1-star reviews
15,994 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Heather D.20 September 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
It was exactly like the pic on Zazzle. Size was good to write on the back. Image was great. Lovely colours and clear
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dash K.23 January 2024Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I was pleased with the excellent quality of the calendar and the high quality of the card stock used. I will definitely order these postcards again. The printing was excellent. I was so pleased!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa B.26 August 2019Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Such a huge range of different frogs available, which made my choices very difficult and now the reason I have a whole draw full of cards and postcards! Much better quality than you can buy in the shops and they are exactly on the subject I love and adore too.

Tags

Postcards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 239192120133082062
Posted on 25/04/2010, 1:19 PM
Rating: G