Tap / click on image to see more RealViewsTM
$53.35
per tie
 

Caduceus Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Caduceus Tie

Caduceus Tie

Design that makes caduceus motif

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1773 total 5-star reviews321 total 4-star reviews131 total 3-star reviews64 total 2-star reviews96 total 1-star reviews
2,385 Reviews
Reviews for similar products
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Product was of good quality. The fabric is excellent
5 out of 5 stars rating
By Janette C.28 February 2016Verified Purchase
Tie
Zazzle Reviewer Program
Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
5 out of 5 stars rating
By Libby L.14 July 2017Verified Purchase
Tie
Zazzle Reviewer Program
Item is of very good quality. The fabric is excellent

Tags

Ties
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 151268738381438883
Posted on 25/04/2010, 1:10 PM
Rating: G