Tap / click on image to see more RealViewsTM
$58.00
per mug
 

Caduceus Travel Mug

Qty:
Travel/Commuter Mug
-$20.90
-$18.80
-$16.85
Stainless Steel

Other designs from this category

About Mugs

Sold by

Style: Travel/Commuter Mug

You don’t have to give up a colourful, funny, or attractive design for the function of a top-notch travel mug. Zazzle’s commuter mugs feature a rubber-lined lid for a tight, spill-resistant seal — twist the lid to reveal the sip opening! So, take your favourite photo, monogram, pattern, or cool design with you on your new favourite mug.

  • Dimensions: 414 ml: 6.4 cm diameter base x 8.9 cm diameter x 15.7 cm height
  • Materials: Stainless steel body; plastic handle and base; rubber-lined plastic lid
  • Double-walled stainless steel helps keep your drink hot
  • Do not microwave; hand wash recommended
  • Printed on demand in San Jose, California, USA
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Caduceus Travel Mug

Caduceus Travel Mug

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19602 total 5-star reviews1854 total 4-star reviews342 total 3-star reviews155 total 2-star reviews275 total 1-star reviews
22,228 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous27 August 2025Verified Purchase
Travel/Commuter Mug, 444 ml
Very happy with both the quality of the print and travel mug itself. Was hesitant being from NZ that the item wouldn't arrive in time for Father's day given the shipping guidelines, but it took only 5 days to arrive - 2 days before estimated delivery. Highly recommended. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Janette C.28 February 2016Verified Purchase
Travel/Commuter Mug, 444 ml
Zazzle Reviewer Program
Excellent well made, great gift for a man on the go. Good clear black writing. Very happy.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Suzanne H.28 January 2025Verified Purchase
Travel/Commuter Mug, 444 ml
Creator Review
My husband loves his custom personalized Bible verse travel mug, here’s a screenshot of his Facebook post he shared on social media.
from zazzle.com (US)

Tags

Mugs
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 168682776586601869
Posted on 25/04/2010, 1:17 PM
Rating: G