Tap / click on image to see more RealViewsTM
$40.95
per hat
 

Caduceus Trucker Hat

Qty:
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker Hat

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. Customise the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 43.18 cm to 60.96 cm
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 colour combinations
Recommended for ages 13+

This product can expose you to chemicals including Diisononyl phthalate (DINP), which is known to the State of California to cause cancer / birth defects or other reproductive harm. For more information go to www.P65Warnings.ca.gov.

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.3K Total Reviews
1918 total 5-star reviews324 total 4-star reviews65 total 3-star reviews18 total 2-star reviews23 total 1-star reviews
2,348 Reviews
Reviews for similar products
4 out of 5 stars rating
By Roimata K.26 October 2021Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
I totally love my hats. I love the designs,how the trucker hat fits, the product is amazing. And I can't stop buying them. Very well done, centered well.
5 out of 5 stars rating
By Amandine K.22 September 2015Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
arrived 16 days after shipping , but not disappointed, really nice quality :) I'll definitely book an other one very soon! amazing , even better than on the website! the color are awesome ! :)
5 out of 5 stars rating
By Janice W.22 March 2022Verified Purchase
Trucker Hat, Tan and Brown
Zazzle Reviewer Program
great present well made and a good fit thanks so much. well made a very nice hat great service

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Posted on 26/04/2010, 7:24 AM
Rating: G