Tap / click on image to see more RealViewsTM
$40.95
per hat
 

Caduceus Trucker Hat

Qty:
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. customise the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 117.8 cm to 210.2 cm
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 colour combinations
Recommended for ages 6+

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
1942 total 5-star reviews325 total 4-star reviews68 total 3-star reviews22 total 2-star reviews26 total 1-star reviews
2,383 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amandine K.22 September 2015Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
arrived 16 days after shipping , but not disappointed, really nice quality :) I'll definitely book an other one very soon! amazing , even better than on the website! the color are awesome ! :)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Janice W.22 March 2022Verified Purchase
Trucker Hat, Tan and Brown
Zazzle Reviewer Program
great present well made and a good fit thanks so much. well made a very nice hat great service
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cushla H.26 February 2017Verified Purchase
Trucker Hat, White and Navy
Zazzle Reviewer Program
Great looked for this hat for many years not able to get them in New Zealand and american showed me site. perfect love it would recommend to all

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Posted on 26/04/2010, 7:24 AM
Rating: G