Tap / click on image to see more RealViewsTM
$60.15
per roll
 

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Qty:
  1. Size

  2. Paper Finish

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Charming Blush Pink Sweet Candy Cane Gift  Wrapping Paper

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper

Wrap your gifts in the essence of holiday sweetness with our Charming Blush Pink Sweet Candy Cane Gift Wrap. Designed with a girlish charm, this wrapping paper features an adorable candy cane motif set against a delicate blush pink background, perfect for adding a dash of whimsy to your present presentation. The soft pink hues blend with the classic candy cane design to create a cute and inviting package, ideal for the holiday season. Whether it's for Christmas morning or a special winter celebration, this paper is sure to make your gifts stand out under the tree, delighting recipients of all ages with its delightful and playful pattern.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3413 total 5-star reviews380 total 4-star reviews116 total 3-star reviews74 total 2-star reviews110 total 1-star reviews
4,093 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pauline12 November 2023Verified Purchase
Wrapping Paper, Matte
Zazzle Reviewer Program
Quality paper and ribbons. To personalise took no longer and I will be so excited to see the grandchildren’s faces on Christmas day that I took the time to help this day be memorable. Clear and precise on quality matt paper that looks modern and memorable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous10 March 2025Verified Purchase
Wrapping Paper, Matte
My husband was super impressed with the personalized wrap.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Audrey W.20 May 2022Verified Purchase
Wrapping Paper, Matte
Zazzle Reviewer Program
very happy with the paper, excellant service. excellant very cute with the colourful bee's

Tags

Wrapping Paper
All Products
christmas wrapping papercandy canecutesimpleblush pinkgirlypinkpatternsweetfeminine

Other Info

Product ID: 256647581624454889
Posted on 9/12/2023, 6:11 AM
Rating: G