Tap / click on image to see more RealViewsTM
$16.45
per set of 3 sheets
 

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper Sheet

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customisable! Mix and match designs to create unique combinations
  • Dimensions: (3) 48 cm x 73 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper Sheet

Charming Blush Pink Sweet Candy Cane Gift Wrapping Paper Sheet

Wrap your gifts in the essence of holiday sweetness with our Charming Blush Pink Sweet Candy Cane Gift Wrap. Designed with a girlish charm, this wrapping paper features an adorable candy cane motif set against a delicate blush pink background, perfect for adding a dash of whimsy to your present presentation. The soft pink hues blend with the classic candy cane design to create a cute and inviting package, ideal for the holiday season. Whether it's for Christmas morning or a special winter celebration, this paper is sure to make your gifts stand out under the tree, delighting recipients of all ages with its delightful and playful pattern.

Customer Reviews

4.8 out of 5 stars rating1K Total Reviews
945 total 5-star reviews45 total 4-star reviews13 total 3-star reviews4 total 2-star reviews20 total 1-star reviews
1,027 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nicky B.4 September 2025Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Creator Review
Extremely good quality wrapping - perfect for what I needed. .
5 out of 5 stars rating
By Fi S.24 March 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Zazzle Reviewer Program
So happy with the product. They warned it could be blurry on printing but I love it and there’s no blurriness at all. So good! It very clear :)
5 out of 5 stars rating
By J.8 December 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Zazzle Reviewer Program
Love the design! Would 100% recommend it! Looks exactly as the pictures! Perfect! 😊

Tags

Wrapping Paper Sheet Sets
All Products
christmas wrapping papercandy canecutesimpleblush pinkgirlypinkpatternsweetfeminine

Other Info

Product ID: 256962683403636231
Posted on 9/12/2023, 6:17 AM
Rating: G