Tap / click on image to see more RealViewsTM
$50.85
per pack of 100
 

Cherries Business Cards

Qty:
Squared
+$11.65
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$9.80
-$9.80
+$9.80
+$9.80
+$9.80
+$9.80
+$9.80
+$9.80
+$27.30

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating38.3K Total Reviews
32112 total 5-star reviews3792 total 4-star reviews955 total 3-star reviews575 total 2-star reviews855 total 1-star reviews
38,289 Reviews
Reviews for similar products
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend
5 out of 5 stars rating
By S M.27 May 2022Verified Purchase
Business Card, Size: Mini, 76 mm x 25 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
Very cute wee cards to attach to my products, customers adore them also. Spot On! Thank you so much
5 out of 5 stars rating
By Vaneasa C.30 January 2023Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
Quality and professional looking cards. I love them. The printing is of professional standards. I couldn't have asked for better.

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Posted on 24/03/2008, 5:47 PM
Rating: G