Tap / click on image to see more RealViewsTM
$36.45
per shirt
 

Cherry Hearts Cute and Funny T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: White

    Classic Printing: No Underbase
    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customise it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Cherry Hearts Cute and Funny  T-Shirt

Cherry Hearts Cute and Funny T-Shirt

Sweet, playful, and full of charm, this Cherry Hearts T‑shirt brings a fresh twist to classic Valentine style. Featuring a cute cherry motif paired with heart‑shaped accents, it’s perfect for anyone who loves fun, flirty designs with a touch of retro sweetness. Whether you’re dressing for Valentine’s Day, gifting someone special, or simply adding a little love‑themed flair to your everyday wardrobe, this tee delivers cheerful vibes and effortless style.

Customer Reviews

4.5 out of 5 stars rating15K Total Reviews
10657 total 5-star reviews2874 total 4-star reviews838 total 3-star reviews400 total 2-star reviews268 total 1-star reviews
15,037 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Haley31 March 2024Verified Purchase
My Clan Graham is high quality garment and its history even more important, Clan Graham fought for the right to wear kilts and won. Clan Graham, Duke of Montrose are advisors to China on renewable energy. Heavy duty Cotton. The design and colours are superb, I feel very proud as a Graham descendant from Appleby Westmorland Cumbria to wear this especially when wearing of patches is banned in Aotoearoa - New Zealand. Kiwis wear all black as the t shirt is with Green lettering to match the environment and yellow for joy and purple thistle to match my hair. The wardrobe police know who my Clan is now !
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Merv11 June 2017Verified Purchase
Basic T-Shirt, White, Large
Zazzle Reviewer Program
The tee shirt was of good quality and the photo true to original. The printing was just fine, as usual.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jenny S.11 July 2024Verified Purchase
Basic T-Shirt, Black, XL
Creator Review
Comfortable fit and well made shirt. . I was really impressed with how well the print came out considering it was from a photo of my original art work. Appears to wash well so far too.

Tags

All Products
cherryheartfunkycutesweetvalentinegraphicflirtycherries

Other Info

Product ID: 256124709515819054
Posted on 6/02/2026, 12:27 PM
Rating: G