Tap / click on image to see more RealViewsTM
$46.40
per apron
 

Christmas Holiday Silver Snowflake Star Design Standard Apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Christmas Holiday Silver Snowflake Star Design Standard Apron

Christmas Holiday Silver Snowflake Star Design Standard Apron

Christmas Holiday Silver Snowflake Star Design. Customise with text, colour or a photo. Reduce or increase the size. Add colour to the white background by selecting edit and background. Choose blue, yellow, pink, purple, red, green, orange, brown or black.

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
1935 total 5-star reviews302 total 4-star reviews39 total 3-star reviews14 total 2-star reviews12 total 1-star reviews
2,302 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lorraine S.4 January 2022Verified Purchase
Zazzle Reviewer Program
Excellent quality, fabric good weight and well constructed, fit for purpose, printing was good and clear. product was bought already printed, excellent quality
Original product
5 out of 5 stars rating
By Lynn S.23 March 2022Verified Purchase
Apron, Standard
Zazzle Reviewer Program
I was so excited with the aprons and they look amazing. Can't wait to use these at Christmas with my Grandchildren in the play food truck we are making them. Loved the printing it turned out really well
5 out of 5 stars rating
By Murray W.31 August 2020Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This product was surprisingly good, robust and strong - I was expecting to use the product just as a BBQ apron - instead I use it as a multi purpose carryall - using the apron for light tools, screws and nuts when working on my vehicles or minor DIY projects, holding gardening implements and seeds or the BBQ. Extremely well made and the customised motif was superb and certainly gets favourable comments in New Zealand. Colours are excellent and standout.

Tags

Aprons
christmasholidaysilversnowflakestardesignfriendsfamilyshoppingphoto
All Products
christmasholidaysilversnowflakestardesignfriendsfamilyshoppingphoto

Other Info

Product ID: 154137641223617399
Posted on 18/11/2013, 7:53 PM
Rating: G