Tap / click on image to see more RealViewsTM
$32.40
$4.05 per paper plate
 

Christmas Open House Paper Plates 9"

Qty:
Personalise this template
22.86 cm Round Paper Plate
-$0.55
-$0.10
-$0.65

Other designs from this category

About Paper Plates

Sold by

Size and Style: 22.86 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving dinner, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 22.8 cm diameter
  • FDA compliant for food contact safety
  • Great for serving dinners, lunches, appetizers, or salads
  • Printed in USA

About This Design

Christmas Open House Paper Plates 9"

Christmas Open House Paper Plates 9"

Welcome, guests to your holiday home with a custom made a paper plate. Personalise this plate with your own words.***This graphic design was created from public domain illustrations that were layered onto the plate.

Customer Reviews

4.6 out of 5 stars rating1.3K Total Reviews
1064 total 5-star reviews100 total 4-star reviews39 total 3-star reviews37 total 2-star reviews55 total 1-star reviews
1,295 Reviews
Reviews for similar products
4 out of 5 stars rating
By Anonymous20 October 2025Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Very happy with the plates.
4 out of 5 stars rating
By Orianne M.24 August 2021Verified Purchase
Paper Plates, 17.78 cm Round Paper Plate
Zazzle Reviewer Program
I really liked that the design I created was exactly what I received. The plates are of good quality. I am not sure how long they last while in use but I would be fairly confident that they are good. However, it is a pricey piece for a single use item. exceptional, exactly what I expected
5 out of 5 stars rating
By Tracy F.6 November 2021Verified Purchase
Paper Plates, 22.86 cm Round Paper Plate
Zazzle Reviewer Program
When I chose this theme for my friends baby shower I was thrilled to see that the plates were offered on Zazzled. I was even more thrilled when they arrived on time and we’re ABSOLUTELY PERFECT!!! And the quality of the plate was great as well! I was worried they’re be flimsy but they were nice and sturdy for our hot foods! Absolutely PERFECT! I couldn’t have been happier. Everyone was so impressed!
from zazzle.com (US)

Tags

Paper Plates
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate
All Products
holiday partyopen housesnowmanfamilyfriendschristmaspaper plate

Other Info

Product ID: 256495157307116895
Posted on 20/06/2017, 8:51 PM
Rating: G