Tap / click on image to see more RealViewsTM
$114.00
per fleece blanket
 

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 154.2 cm (50 in x 60 in)

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (76.2 cm x 101.6 cm); medium(127 cm x 152.4 cm); large(152.4 cm x 203.2 cm).
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

Classic Plaid Tartan Pattern-Dark Navy & White Fleece Blanket

This fleece blanket features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design brings a timeless, heritage‑inspired look that works beautifully in both modern and traditional spaces. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it a stylish accent for bedrooms, living rooms, or anywhere you want to add warmth and character

Customer Reviews

4.8 out of 5 stars rating3.4K Total Reviews
2964 total 5-star reviews332 total 4-star reviews64 total 3-star reviews47 total 2-star reviews28 total 1-star reviews
3,435 Reviews
Reviews for similar products
5 out of 5 stars rating
By N.18 January 2023Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
Quality perfect, absolutely amazing deal, my mother's Xmas gift after loosing her lifelong companion dog, years all around when opening, she will cherish this forever, I highly recommend. Great quality pictures
5 out of 5 stars rating
By J.22 January 2022Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm
Zazzle Reviewer Program
I was a little nervous to begin with, wondering about how it would turn out. I was delighted with the quality and softness of the Blanket and how well the photos turned out. I was excited to give the gift to my elderly Father. Image quality was better than I expected
5 out of 5 stars rating
By Evelyn M.29 December 2022Verified Purchase
Fleece Blanket, Large 152.4 cm x 203.2 cm
Zazzle Reviewer Program
Kids really loved the blankets. Soft and perfect for a snuggle blanket. Much better than I had expected with just phone photos.

Tags

Fleece Blankets
classicplaidfleeceblankettartanpatternthrowblanketgeometriccheckfleecetimelessplaidhomedecormoderntraditionalblanketstructuredgridpatternversatilepatternthrowstatementplaidblanketsymmetricalcheckdesigndarknavywhiteplaidfleeceblanket
All Products
classicplaidfleeceblankettartanpatternthrowblanketgeometriccheckfleecetimelessplaidhomedecormoderntraditionalblanketstructuredgridpatternversatilepatternthrowstatementplaidblanketsymmetricalcheckdesigndarknavywhiteplaidfleeceblanket

Other Info

Product ID: 256183248903541793
Posted on 9/09/2025, 2:12 AM
Rating: G