Tap / click on image to see more RealViewsTM
$65.30
per All-Over Print Apron
 

Classic Plaid Tartan Pattern-Navy & White Apron

Qty:
Black
Medium
-$8.50
+$5.70

Other designs from this category

About All-Over Print Aprons

Sold by

Size: All-Over Print Apron, Medium 66.04 cm x 76.2 cm

Whether you are cooking at home, hosting a summer BBQ, or creating arts & crafts- do so in style with our fully customisable aprons! Made of a top quality polyester, our fully sublimation designs will definitely make a great impression on your guests. Available in 3 sizes for adults, young adults, children- basically everyone! Each size is adorned with a sublimated neck strap and adjustable waist string to ensure the best design results.

  • Dimensions: 76.2 cm length x 66.04 cm width
  • Waist String 87.63 cm
  • Material: 100% Polyester
  • Full Dye Sublimation
  • One Side Printing Available
  • Machine wash in cold water on gentle cycle with mild detergent. Do not bleach or iron. Line dry.

About This Design

Classic Plaid Tartan Pattern-Navy & White Apron

Classic Plaid Tartan Pattern-Navy & White Apron

This apron features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design blends heritage charm with modern versatility, making it a stylish and functional choice for cooking, baking, crafting, or hosting. Its repeating grid motif adapts beautifully to any colour palette — from understated neutrals to bold, high‑contrast combinations — ensuring it complements a wide range of personal styles and kitchen décor

Customer Reviews

4.7 out of 5 stars rating653 Total Reviews
569 total 5-star reviews41 total 4-star reviews5 total 3-star reviews8 total 2-star reviews30 total 1-star reviews
653 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By K.9 January 2023Verified Purchase
All-Over Print Apron, Large
Zazzle Reviewer Program
Great product quality. Printing quality was Fantastic
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous27 August 2025Verified Purchase
All-Over Print Apron, Medium
this is absolutely perfect. thanks .
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.6 January 2022Verified Purchase
All-Over Print Apron, Small
Zazzle Reviewer Program
This was beautiful, purchased for grand daughter and she loved it - highly recommend. Absolutely perfect !!!

Tags

All-Over Print Aprons
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron
All Products
classicplaidaprontartanpatternaprongeometriccheckaprontimelessplaidhomedecormoderntraditionalapronstructuredgridpatternversatilepatternapronstatementplaidapronsymmetricalcheckdesignnavywhiteplaidapron

Other Info

Product ID: 256443526394758011
Posted on 12/09/2025, 5:24 PM
Rating: G