Tap / click on image to see more RealViewsTM
$79.75
per cushion
 

Classic Plaid Tartan Pattern-Navy & White Cushion

Qty:
Throw Cushion 40.6 x 40.6 cm
+$14.70
+$39.55

Other designs from this category

About Cushions

Sold by

Size: Throw Cushion 40.6 x 40.6 cm

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

Classic Plaid Tartan Pattern-Navy & White Cushion

Classic Plaid Tartan Pattern-Navy & White Cushion

This throw pillow features a classic plaid tartan pattern with crisp, intersecting lines and perfectly balanced symmetry. The structured check design adds a timeless, heritage‑inspired touch that works beautifully in both modern and traditional interiors. Its versatile, repeating grid motif adapts effortlessly to any colour palette — from soft neutrals to bold, high‑contrast combinations — making it an easy accent for sofas, beds, chairs, or cosy reading nooks

Customer Reviews

4.8 out of 5 stars rating7.2K Total Reviews
6200 total 5-star reviews699 total 4-star reviews149 total 3-star reviews60 total 2-star reviews67 total 1-star reviews
7,175 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aashmin W.18 January 2022Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
Just amazing and such a quick delivery . Very high quality fabric I must say
5 out of 5 stars rating
By Dianne s.22 August 2021Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
The ordering process was easy, I was warned my image may be slightly blurry due to condition of my image however when cushions arrived there was no blurriness and pixels look great. Didn't take long to arrive at all, overall very happy 😀. Great print work and it looks awesome
5 out of 5 stars rating
By K.14 March 2021Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm
Zazzle Reviewer Program
I am thrilled with this cushion, it is exactly as explained and a real statement piece on my moss green lounge suite. I love this cushion and have had many comments about where I purchased it from!

Tags

Cushions
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow
All Products
classicplaidthrowpillowtartanpatternpillowcovergeometriccheckpillowtimelessplaidhomedecormoderntraditionalpillowstructuredgridpatternversatilepatternpillowstatementplaidcushionsymmetricalcheckdesignnavywhiteplaidthrowpillow

Other Info

Product ID: 256005583188580567
Posted on 9/09/2025, 4:48 AM
Rating: G