Tap / click on image to see more RealViewsTM
Sale Price $3.53.  
Original Price $4.70 per card
You save 25%

Cute Girly Princess Crown Pink Photo Watercolor Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30
+$1.00
+$1.00
+$2.45
+$1.00

Other designs from this category

Shop this collection

Ioana Nedelcu
PRINCESS BIRTHDAYDesigned by Ioana Nedelcu
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Cute Girly Princess Crown Pink Photo Watercolor   Invitation

Cute Girly Princess Crown Pink Photo Watercolor Invitation

This cute modern Princess invitation is perfect for your daughter's royal birthday bash. This enchanting design features a delicate white crown motif and Cinderella's magical essence, set against a vibrant pink backdrop, exuding grace and sophistication. The minimalist crown adds a regal touch, accompanied by classic black and white text for clarity and style. Celebrate your little princess in a whimsical manner with this customisable invitation, where you can include her name in beautiful handwriting. Elevate the magic further by adding a customisable photo of your princess. Available in both print and digital download formats, it's the ultimate choice for a memorable celebration.

Customer Reviews

4.8 out of 5 stars rating68.7K Total Reviews
60873 total 5-star reviews5635 total 4-star reviews999 total 3-star reviews473 total 2-star reviews736 total 1-star reviews
68,716 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kelsy J.24 January 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Perfect and beautiful. Printing was fantastic, exactly what I thought it would be
5 out of 5 stars rating
By T.20 October 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Very happy with my order, the invitations are gorgeous. Price was good and delivery was pretty quick. Would definitely recommend this product. 5 Star! Thank you.
5 out of 5 stars rating
By Erica J.21 February 2023Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, High Definition, Envelopes: White
Zazzle Reviewer Program
It was easy to put in the text and it came out exactly how I wanted it to. So many styles to choose from that were lovely for a birthday invitation. Quality of invitation was great and overall very happy. Would definitely use again. It was what I expected but wished it did have glitter.

Tags

Invitations
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto
All Products
watercolorgirly pinkprincess birthday partywhite and pinkcinderellafairytalemagical fairyroyal5th birthdayphoto

Other Info

Product ID: 256411210124026350
Posted on 24/03/2024, 6:52 AM
Rating: G