Tap / click on image to see more RealViewsTM
$5.85
per sticker
 

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 5 cm L x 2.12.7 cm W
  • Design Area: 5 cm L x 5 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

Cute Rabbit on Fluffy Pancake-Pancake Pajama Bunny

🥞🐰💖✨🥞🐰💖✨ "Drift into a sweet dream with this adorable baby bunny, snuggled up in its cute pajamas right on top of a giant, fluffy pancake! 🐰🥞 This design embodies pure comfort and ultimate dreamy kawaii charm, perfect for pancake lovers, sleepy animal fans, and anyone who adores unique cute art with a heartwarming, cozy touch. Fully customizable for any Zazzle product, it makes a perfect gift or a lovely treat for yourself! Let this sweet scene bring warmth and smiles to your world! 💖 This design is fully customizable - add your own text or image to make it uniquely yours!" 🥞🐰💖✨ "Schweben Sie in süße Träume mit diesem bezaubernden Babyhäschen, das sich in seinem niedlichen Schlafanzug direkt auf einem riesigen, flauschigen Pfannkuchen einkuschelt! 🐰🥞 Dieses Design verkörpert puren Komfort und ultimativen verträumten Kawaii-Charme, perfekt für Pfannkuchenliebhaber, schläfrige Tierfans und alle, die einzigartige niedliche Kunst mit einem herzerwärmenden, gemütlichen Touch lieben. Vollständig anpassbar für jedes Zazzle-Produkt, ist es ein perfektes Geschenk oder eine nette Belohnung für Sie selbst! Lassen Sie diese süße Szene Wärme und Lächeln in Ihre Welt bringen! 💖 Dieses Design ist vollständig anpassbar - fügen Sie Ihren eigenen Text oder Ihr eigenes Bild hinzu, um es einzigartig zu machen!" 🥞🐰💖✨ "Plongez dans un doux rêve avec cet adorable bébé lapin, confortablement installé dans son joli pyjama directement sur une immense et moelleuse crêpe ! 🐰🥞 Ce design incarne le confort pur et le charme kawaii onirique ultime, parfait pour les amoureux des crêpes, les fans d'animaux endormis, et tous ceux qui adorent l'art mignon unique avec une touche réconfortante et douillette. Entièrement personnalisable pour tout produit Zazzle, c'est un cadeau parfait ou une jolie gâterie pour vous-même ! Laissez cette douce scène apporter chaleur et sourires à votre monde ! 💖 Ce design est entièrement personnalisable - ajoutez votre propre texte ou image pour le rendre unique !" 🥞🐰💖✨ "Naviga in un dolce sogno con questo adorabile coniglietto, accoccolato nel suo grazioso pigiama proprio in cima a un enorme e soffice pancake! 🐰🥞 Questo design incarna il comfort puro e il massimo del fascino kawaii sognante, perfetto per gli amanti dei pancake, i fan degli animali assonnati e chiunque adori l'arte unica e carina con un tocco commovente e accogliente. Completamente personalizzabile per qualsiasi prodotto Zazzle, è un regalo perfetto o una deliziosa coccola per te stesso! Lascia che questa dolce scena porti calore e sorrisi nel tuo mondo! 💖 Questo design è completamente personalizzabile: aggiungi il tuo testo o la tua immagine per renderlo unico!" 🥞🐰💖✨ "A dreamlike scene where a baby rabbit in a cute pajamas is sitting on a fluffy pancake! 🐰🥞 This design embodies the ultimate comfort and dream kawaii charm, perfect for pancake lovers, good-night animal fans, and everyone who loves unique and cute art that is heartwarming! You can customize any item in Zazzle, so it's perfect for perfect gifts and a nice reward for yourself! May this sweet scene bring warmth and smile to your world! 💖 This design is freely customizable - you can add your text or pictures to make it your only special item! " #PancakeBunny, #PajamaCute, #FluffyPancake, #KawaiiArt, #SweetDreams, #AdorableAnimal, #DreamyCute, #Yumekawaii, #CozyVibes, #BedtimeBunny #AntiqueCafe, #KawaiiArt, #CuteRabbit, #SweetTreats, #FluffyBunny, #DreamyCute, #Yumekawaii, #VintageStyle, #ElegantCute .🌟🐰#YUMEKWAAII, #KawaiiRabbit, #MagicalPlay, #DreamyPastel, #FantasyCute, #UnicornLover, #AdorableAnimal, #SweetFriends #DreamyPastel, #CelestialArt, #CuteSpace, #StarryNight, #RetroKawaii, #HeartPalette, #KawaiiMakeup, #SparkleBunny, #PinkAesthetic, #GlitterArt, #Gemstone, #SparkleKawaii, #DreamyPastel, #LuxuryCute, #JewelLover, #BrilliantArt

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
917 total 5-star reviews71 total 4-star reviews27 total 3-star reviews32 total 2-star reviews91 total 1-star reviews
1,138 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By R.3 September 2021Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Its is the perfect size and very clear image I love my purchase. The printing was very clear and will definitely be going back for more
5.0 out of 5 stars rating
5 out of 5 stars rating
By Baby C.24 June 2024Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Ok so i thought the drink bottle came with it 🤔 😂 Bit confusing But am happy about the outcome of the stickers. Perfectly made. Its awesome to see my Avatar as a sticker
5.0 out of 5 stars rating
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.

Tags

Custom-Cut Vinyl Stickers
pancakebunnypajamacutefluffypancakekawaiiartsweetdreamsadorableanimaldreamycuteyumekawaiicozyviousbedtimebunny
All Products
pancakebunnypajamacutefluffypancakekawaiiartsweetdreamsadorableanimaldreamycuteyumekawaiicozyviousbedtimebunny

Other Info

Product ID: 256358561901776110
Posted on 9/06/2025, 6:54 AM
Rating: G