Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
$21.45
per notebook
 

Daisy Chain - Notebook (Bright Pink)

Qty:

    Other designs from this category

    About Notebooks

    Sold by

    Style: 16.51 cm x 22.22 cm Classic Notebook

    Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

    • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
    • Cover printed in vibrant, sharp colour
    • 80 black & white lined pages
    • College ruled
    • Lay flat spiral binding
    This product is recommended for ages 8+..
    Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

    About This Design

    The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
    Daisy Chain - Notebook (Bright Pink)

    Daisy Chain - Notebook (Bright Pink)

    A modern take on a sweet floral motif, Daisy Chain feels both playful and refined. The repeating pattern brings movement and rhythm, while the high-contrast palette keeps it crisp and graphic. Designed with a Scandinavian sensibility—simple, bold, and intentional—this adds personality without feeling overdone. It’s the kind of piece that stands out on its own but still works effortlessly with everything else you carry. Lighthearted, modern, and a little unexpected—this is everyday design done right.

    Customer Reviews

    4.8 out of 5 stars rating1.8K Total Reviews
    1505 total 5-star reviews185 total 4-star reviews41 total 3-star reviews27 total 2-star reviews14 total 1-star reviews
    1,772 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Kirsty R.1 January 2025Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Happy as with the book, the pages are plenty with happy with the thickness and lines of each page. Purchased another 2 books soon after purchasing the first 2!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Myra26 February 2024Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    Very good exactly what I was looking for. Just how I had asked for
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Susan H.20 April 2021Verified Purchase
    16.51 cm x 22.22 cm Classic Notebook
    Zazzle Reviewer Program
    Excellent product and would purchase again. Excellent - as above

    Tags

    Notebooks
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine
    All Products
    modernscandinavianartsyfloraldaisylacepinkgirlydelicatefeminine

    Other Info

    Product ID: 256029940409343732
    Posted on 27/03/2026, 3:26 PM
    Rating: G