Tap / click on image to see more RealViewsTM
$13.95
per sticker
 

Discover Hidden Wonders - Vintage Magnifying Glass

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Discover Hidden Wonders - Vintage Magnifying Glass

Discover Hidden Wonders - Vintage Magnifying Glass

Unearth the magic of nostalgia with our Vintage Magnifying Glass Sticker! Dive into the enchanting world of discovery and wonder as you explore the intricacies of this cool vintage illustration. This sticker isn't just an accessory; it's a gateway to a world filled with art, history, and the joy of exploration. Whether you're a lover of art, history, or simply appreciate the beauty of intricate design, this sticker brings a touch of aesthetic elegance to your life. Feel the excitement of a new adventure every time you gaze upon this meticulously crafted piece. Printed on-demand exclusively for you, this sticker embodies the essence of your passions - art, history, and the desire to connect with the beauty of the past. Peel it, stick it, and let it transport you to a place where curiosity knows no bounds. Embrace the spirit of discovery and turn any surface into a canvas of imagination. Get your Vintage Magnifying Glass Sticker today, and let the journey begin. It's not just a sticker; it's a feeling waiting to be discovered.

Customer Reviews

4.9 out of 5 stars rating38 Total Reviews
36 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
38 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.16 August 2023Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The material is allotcthicker and works well...colors allot more solid than before, improved printing...no ink jet print affects. Just adhesion level abit low the use on certain plastics. The colors were allot more solid than the last ones and didn't look like "ink jet printer" quality...more improved this time round... The stick adhesion was abit low than I expected and so doesn't stick on to every kind of plastic...thus using 3M stick to aid adhesion. Just need to improve the adhesion levels.
5 out of 5 stars rating
By Georgia B.4 May 2022Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
they are so bright and awesome, I love these and I'm so happy how they turned out. I think great. I think the printing is amazing.
5 out of 5 stars rating
By Debra S.10 July 2024Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
magnifying glasscoolvintageillustrationretrographicmagnifyingmagnifynewspapermagnifier
All Products
magnifying glasscoolvintageillustrationretrographicmagnifyingmagnifynewspapermagnifier

Other Info

Product ID: 256837628795514461
Posted on 18/03/2023, 9:44 AM
Rating: G