Tap / click on image to see more RealViewsTM
$18.60
$6.20 per sheet of tissue paper
 

Distressed Sun Decoupage Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 45.72 cm x 60.96 cm

Make all of your gifts perfectly unique with personalised tissue paper. Give your gifts a sweet, personal touch with designs, photos, images, and text printed on this gift wrapping essential. Impress your friends and family with your amazing style!

  • Please note that this size tissue arrives folded
  • Dimensions: 45.72 cm L x 60.96 cm W unfolded
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Distressed Sun Decoupage Tissue Paper

Distressed Sun Decoupage Tissue Paper

Unleash the warmth and allure of the sun with this exquisite Distressed Sun Decoupage Tissue Paper. Its vintage-inspired design evokes a sense of nostalgic charm and tranquility. Crafted with meticulous detail, the tissue paper features a distressed sun motif, rendered in ethereal shades of gold and amber. The aged effect lends an air of timelessness, inviting you to create projects that resonate with both the past and present. Whether you’re a seasoned artist, a home décor enthusiast, or simply seeking to add a touch of warmth to your life, this high-quality tissue paper is the perfect companion. Its versatility allows you to transform ordinary surfaces into extraordinary works of art. -Distressed sun design for a vintage esthetic -Shimmering gold and amber hues add depth and warmth -Premium tissue paper ensures durability and ease of use -Ideal for découpage, mixed media, scrapbooking, and other creative projects.

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2594 total 5-star reviews150 total 4-star reviews47 total 3-star reviews25 total 2-star reviews43 total 1-star reviews
2,859 Reviews
Reviews for similar products
5 out of 5 stars rating
By Wendy C.10 June 2025Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
So pleased I finally got my order, 1st one went missing in the post. But I Absolutely adore this paper, so whimsical ❤️ thanks it’s so beautiful! .
5 out of 5 stars rating
By A.2 September 2025Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Love it , quality is great and designs beautiful. Its a shame the sizing and prices changed but won't stop me buying more haha.
5 out of 5 stars rating
By DM S.19 June 2022Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 53.34 cm x 73.66 cm
Zazzle Reviewer Program
It looks stunning on my bedside dresser door. Very bold and colourful

Tags

Tissue Paper
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal
All Products
decoupagesunmagicmysticalancientfacepagannew agefantasysurreal

Other Info

Product ID: 256055763715191733
Posted on 16/08/2024, 6:13 PM
Rating: G