Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
$87.50
per clock
 

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Qty:
27.3 cm Square Acrylic
-$10.05
-$19.85
-$19.85
-$19.85

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Square Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • Size: 27.3 cm L x 27.3 cm H
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Elegant Blush Pink & Silver Glitter Drip  Square Wall Clock

Elegant Blush Pink & Silver Glitter Drip Square Wall Clock

Add a touch of luxury to your space with this elegant Pink Luxe Drip wall clock, featuring shimmering silver and blush pink glitter drips in a circular-shaped motif. Perfect for glam rooms, modern bedrooms, or feminine office décor, this chic timepiece is as functional as it is fabulous. A stunning gift for housewarmings, birthdays, or anyone who loves a little sparkle!

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2830 total 5-star reviews384 total 4-star reviews76 total 3-star reviews41 total 2-star reviews60 total 1-star reviews
3,391 Reviews
Reviews for similar products
5 out of 5 stars rating
By Fiona C.26 July 2024Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
This clock is stunning. I love how I was able to customize and it was very affordable. Mum and dad are going to love it. Thank you so much . Fantastic, very clear
5 out of 5 stars rating
By Ruth G.19 June 2022Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Product arrived in 10 days from America, beautifully packaged. Vivid colours just as shown in picture on the website
5 out of 5 stars rating
By Maureen U.17 May 2021Verified Purchase
Wall Clock, 27.3 cm Square Acrylic
Zazzle Reviewer Program
Excellant, exactly what we wanted. Our click is perfect 👌

Tags

Wall Clocks
sparkleglittermodernglamelegantgirlysilverpink
All Products
sparkleglittermodernglamelegantgirlysilverpink

Other Info

Product ID: 256577969356106432
Posted on 4/09/2025, 12:24 PM
Rating: G