Tap / click on image to see more RealViewsTM
Sale Price $4.09.  
Original Price $5.45 per card
You save 25%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.35
+$1.15
+$1.15
+$2.85
+$1.15

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating68.9K Total Reviews
61014 total 5-star reviews5642 total 4-star reviews1004 total 3-star reviews476 total 2-star reviews749 total 1-star reviews
68,885 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.16 May 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Love that there is a bit of humour with it. Quality card. Really good, clean print job
5 out of 5 stars rating
By Kelsy J.24 January 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Perfect and beautiful. Printing was fantastic, exactly what I thought it would be
5 out of 5 stars rating
By M.6 October 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Absolutely amazing! Exactly what i was looking for. Turned out better colourwise then i expected so im insanely happy!

Tags

All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 161983976605672037
Posted on 29/10/2012, 2:02 PM
Rating: G