Tap / click on image to see more RealViewsTM
Sale Price $3.82.  
Original Price $5.45 per card
You save 30%

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$2.85
+$1.15
+$1.15
-$0.35
+$1.15

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 12 unique paper types and colours to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Elegant Leafy Art Nouveau Arts and Crafts Pattern Invitation

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating68.6K Total Reviews
60772 total 5-star reviews5630 total 4-star reviews988 total 3-star reviews461 total 2-star reviews707 total 1-star reviews
68,558 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.16 May 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Love that there is a bit of humour with it. Quality card. Really good, clean print job
5 out of 5 stars rating
By Kelsy J.24 January 2021Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Perfect and beautiful. Printing was fantastic, exactly what I thought it would be
5 out of 5 stars rating
By M.6 October 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Absolutely amazing! Exactly what i was looking for. Turned out better colourwise then i expected so im insanely happy!

Tags

All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 161983976605672037
Posted on 29/10/2012, 2:02 PM
Rating: G