Tap / click on image to see more RealViewsTM
$29.10
per mouse pad
 

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Qty:
Personalise this template

Other designs from this category

About Mousepads

Sold by

Style: Mouse Pad

Create a great accessory for the only mouse you want scurrying around with a custom mouse pad for your home or office! Decorate it with your favourite image or choose from thousands of designs that look great and protect your mouse from scratches and debris. You can also design fun mouse pads to hand out to new employees or to use as marketing materials!

  • Dimensions: 23.49 cm l x 19.68 cm w
  • High quality, full-colour printing
  • Durable and dust and stain resistant cloth cover
  • Non-slip rubber backing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 23.49 cm x 19.68 cm

About This Design

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Elegant Leafy Art Nouveau Arts and Crafts Pattern Mouse Pad

Chic vintage look with a customisable background colour. Original leave pattern motif by Village Design.

Customer Reviews

4.8 out of 5 stars rating4.7K Total Reviews
4169 total 5-star reviews377 total 4-star reviews75 total 3-star reviews27 total 2-star reviews27 total 1-star reviews
4,675 Reviews
Reviews for similar products
5 out of 5 stars rating
By Angela B.6 December 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
Delivery was so quick , under a week - I was amazed. The product was great quality and better than expected . I will be ordering more form Zazzle ! Printing was fantastic
5 out of 5 stars rating
By C.9 August 2020Verified Purchase
Mousepad
Zazzle Reviewer Program
Delighted with the mouse pad - thick enough to be confortable and much better quality than those in store. The printing was very crisp and the colours vivid
5 out of 5 stars rating
By Tess M.30 January 2022Verified Purchase
Mousepad
Zazzle Reviewer Program
High quality and a bit of funk from your everyday plain mousepad. Excellent quality would highly recommend

Tags

Mousepads
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant
All Products
art nouveauvintagevictorianpatternleavesleafygreentealaquaelegant

Other Info

Product ID: 144388314163988114
Posted on 29/10/2012, 2:02 PM
Rating: G