Tap / click on image to see more RealViewsTM
Sale Price $3.42.  
Original Price $4.55 per card
You save 25%

Elegant Script Botanical Christmas Photo Collage Holiday Card

Qty:
Choose Your Format
Squared
+$0.35
+$0.45
+$0.45
+$0.45
+$0.45
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30
+$1.05
+$1.05
+$2.55
+$1.05

Other designs from this category

About Flat Holiday Cards

Sold by

Size: 12.7 cm x 17.8 cm

Spread joy, share cheer, merry everything and a happy always! Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High quality, full-colour, full-bleed printing on both sides
  • Add photos and text for no additional charge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Elegant Script Botanical Christmas Photo Collage Holiday Card

Elegant Script Botanical Christmas Photo Collage Holiday Card

This multi-photo Christmas holiday card is a perfect choice this Christmas season! It features a photo collage of three favourite family photos on the top. Underneath there are your Christmas greetings in a modern whimsical elegant script. Below is your family name and year in a simple typography. The card is framed on the bottom by lovely watercolor greenery: eucalyptus and red winter berries. The reverse of the card features the same botanical motif as well as your custom Christmas wishes! Create your own perfect Christmas greeting card by clicking on the ´´Personalise´´ button and changing the pictures and wording to your own!

Customer Reviews

4.8 out of 5 stars rating9.5K Total Reviews
7941 total 5-star reviews1171 total 4-star reviews213 total 3-star reviews88 total 2-star reviews107 total 1-star reviews
9,520 Reviews
4 out of 5 stars rating
By James C.4 December 2024Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Beautiful cards, I am very pleased with the results. A few friends and family have already texted me to tell me how beautiful this year's card is, simple yet elegant. I will definitely buy my Christmas cards from Zazzle in the future. .
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Mary S.9 November 2021Verified Purchase
Flat Holiday Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
This watercolor oval wreath design was perfect for framing this excerpt of my original acrylic painting "Peaceful Winter Scene." I loved the weight and quality of the paper. I feel my Christmas card turned out beautifully. The printing and colors were very good. I do feel the design could have been centered better. My first set - the printing came out fairly close to the top. I ordered a personalized set for a client and the printing on those were not so close to the top.
from zazzle.com (US)
5 out of 5 stars rating
By Kaliste A.1 December 2023Verified Purchase
Flat Holiday Card, Size: 11.4 cm x 15.9 cm, Paper: Signature Matte, Corner: Squared, Envelopes: White
Zazzle Reviewer Program
I really liked the "Merry Christmas" typography on this card, and that there is space for a little message. The pattern on the back is very pretty!! I ordered a sample of this card, so I didn't use my own photos, but all of the 9 images are very detailed. I was a little worried they would turn out blurry or look too small but the card looks just how I saw it on the computer screen.
from zazzle.com (US)

Tags

Flat Holiday Cards
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays
All Products
christmas greenerywatercolorbotanicalphoto collagemulti photo christmasmodernscriptelegantwhimsicalfamily photos christmas holidays

Other Info

Product ID: 256903441749600233
Posted on 26/09/2023, 11:53 PM
Rating: G