Tap / click on image to see more RealViewsTM
$17.65
per window cling
 

Elegant Script Pink 2 Initial Monogram Name Title

Qty:
[10.5000,5.0000]
Automatic Opaque Design: White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaque while also making colours vivid

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Elegant Script Pink 2 Initial Monogram Name Title

Elegant Script Pink 2 Initial Monogram Name Title

Classically femininewindow cling with your initials in pink under your name in an ornate, elegant script and title in a classic black font. A simple yet tasteful divider between them. A classy window cling for your glass door at your office personalised with name, initial, and profession.

Customer Reviews

3.5 out of 5 stars rating236 Total Reviews
132 total 5-star reviews13 total 4-star reviews9 total 3-star reviews16 total 2-star reviews66 total 1-star reviews
236 Reviews
Reviews for similar products
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Front of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! Unusable!!! .
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Rectangle, Display: Back of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! .
1.0 out of 5 stars rating
1 out of 5 stars rating
By Anonymous8 May 2026Verified Purchase
Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Front of Cling, Window Cling
Absolutely a waste of money!!! Awful!!!! Unusable!!! .

Tags

Window Clings
cleanmonogramelegantclassicprofessionalscriptdividerpinkfemininepretty
All Products
cleanmonogramelegantclassicprofessionalscriptdividerpinkfemininepretty

Other Info

Product ID: 256228764042361086
Posted on 9/04/2025, 12:21 PM
Rating: G