Tap / click on image to see more RealViewsTM
$37.10
per keychain
 

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Qty:
Square (single-sided)

Other designs from this category

About Key Chains

Sold by

Shape: Square (single-sided)

Never leave home without your favourite photo, design, or inspirational message attached to your keys with this custom circle key ring. Designed to withstand daily wear and tear, this key ring displays designs, text, and photos in vibrant clarity and brilliant colours.

  • Dimensions: 4.7 cm x 4.7 cm (1.875" x 1.875")
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 4.7 cm x 4.7 cm (1.875" x 1.875"). For best results please add 0.15 cm (.12") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Elegant Thanksgiving Pear Wreath Illustration Key Ring

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating947 Total Reviews
841 total 5-star reviews75 total 4-star reviews14 total 3-star reviews7 total 2-star reviews10 total 1-star reviews
947 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sally R.19 September 2021Verified Purchase
Acrylic Key Ring, Square (single-sided)
Zazzle Reviewer Program
great quality for a good price my partner absolutely loved it for his first Father’s Day definitely recommend buying it for any occasion. The printing was amazing
4 out of 5 stars rating
By Grace C.19 August 2023Verified Purchase
Acrylic Key Ring, Square (single-sided)
Zazzle Reviewer Program
It is simple, nothing too worrying about this except it is only one side. It still looks good though and is light and not to heavy. I like the AE2 artwork on it as it really takes it to another level. Definitely advise using high resolution logos, it does not have a pixelated look when you look at the detail in the lines and looks good for what it is.
from zazzle.com (US)
5 out of 5 stars rating
By Beauty D.11 December 2019Verified Purchase
Acrylic Key Ring, Square (single-sided)
Zazzle Reviewer Program
The customer is satisfied. The print out came out perfect.
from zazzle.com (US)

Tags

Key Chains
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256155350948813937
Posted on 1/11/2020, 6:35 AM
Rating: G