Tap / click on image to see more RealViewsTM
$20.70
$3.45 per coaster
 

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Qty:
Personalise this template
Round
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05
+$0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Round

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customisable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Round Dimensions: 10 cm (4")
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, and absorbent and perfect for parties, weddings or branding your business.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.8 out of 5 stars rating606 Total Reviews
503 total 5-star reviews77 total 4-star reviews14 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
606 Reviews
Reviews for similar products
4 out of 5 stars rating
By S.26 December 2021Verified Purchase
Square Coasters
Zazzle Reviewer Program
The product has a really classy look but the feel of the fabric while good was not not what I had expected. I thought there would be a touch of leather. The printing and the rest of it was all god and classy.
5 out of 5 stars rating
By J.14 August 2019Verified Purchase
Square Coasters
Zazzle Reviewer Program
Can't wait to use our new Christmas coasters! They are so very cute! I love the whimsical design. Well made, sturdy and sizeable! These coasters are perfect for large casual parties even safe to have out by the pool! Colors are dynamic and vibrant and just as pictured. Quality of print is crisp and well defined with no blur.
from zazzle.com (US)
5 out of 5 stars rating
By Keicha B.6 December 2020Verified Purchase
Square Coasters
Zazzle Reviewer Program
These were absolutely adorable!! I just loved having these to set out with my Bitmoji on them. Great I had no complaints at all,
from zazzle.com (US)

Tags

Paper Coasters
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256810345067221464
Posted on 1/11/2020, 6:10 AM
Rating: G