Tap / click on image to see more RealViewsTM
$42.40
per towel
 

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Qty:
Personalise this template

Other designs from this category

About Kitchen Towels

Sold by

Style: Tea Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Elegant Thanksgiving Pear Wreath Illustration Tea Towel

Modern Thanksgiving Wreath Fall Motif Towel

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1008 total 5-star reviews117 total 4-star reviews37 total 3-star reviews12 total 2-star reviews13 total 1-star reviews
1,187 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rebecca S.14 October 2023Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Great personalised gift for a friend that loves to Sail :). Great printing, clear picture
5 out of 5 stars rating
By MEGAN T.16 July 2023Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Great print, design and quality. Looks just like it does in the picture. It caught visitors eye
5 out of 5 stars rating
By Donald M.3 February 2019Verified Purchase
Kitchen Towel
Creator Review
Ecstatic, Eccentric, Eclectic - Excellent, absorbent kitchen towels with vibrant designs. Excellent! Rich pure colors.
from zazzle.com (US)

Tags

Kitchen Towels
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 197652513096200298
Posted on 1/11/2020, 7:18 AM
Rating: G