Sell on Zazzle
Tap / click on image to see more RealViewsTM
$20.60
per sheet of 20
 

Elf Designs :: Magical by MarloDee Designs Square Sticker

4.8 out of 5 stars rating
26798 Total Reviews |
by
Qty:
Shape
Square Stickers
+$0.80
+$0.80
+$0.80
Size
Paper Type

Other designs from this category

About Stickers

Sold by
StickerCreate your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf Designs :: Magical by MarloDee Designs Square Sticker

Elf Designs :: Magical by MarloDee Designs Square Sticker

A lovely elf and a hummingbird together is Magical....( © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.
My Mystical Garden
Silver
Artwork designed by
In the Woods, MN, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating26.8K Total Reviews
23183 total 5-star reviews2185 total 4-star reviews557 total 3-star reviews352 total 2-star reviews521 total 1-star reviews
26,798 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nadine L.24 September 2023 • Verified Purchase
Zazzle Reviewer Program
Very high-quality labels that arrived on or before their stated date. Can not fault the workmanship I am very pleased with the labels and proud to use it on my product. The print was prefect, clear no blurring or smudges
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.7 August 2023 • Verified Purchase
Zazzle Reviewer Program
Stunning and eye catching product label, I be had lots of comments about how simple yet eye catching it is. Great, the green is perfect, the fonts are easy for people to read
5.0 out of 5 stars rating
5 out of 5 stars rating
By alison l.1 March 2023 • Verified Purchase
Zazzle Reviewer Program
I liked this product as can put onto my craft boxes. I did make a typo so will amend that for my next order. Nice clear print, that showcases my art in my photograph.

Tags

Stickers
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell
All Products
elffairyfaemagicmagikmagikalwitchhummingbirdfantasyspell

Other Info

Product ID: 217259878938441739
Posted on 11/10/2011, 1:05 PM
Rating: G