Tap / click on image to see more RealViewsTM
$15.45
per sheet of 20
 

Elf with White Cat Riding on a Leaf Stickers 2

Qty:
Square Stickers
+$0.65
+$0.65
+$0.65

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Elf with White Cat Riding on a Leaf Stickers 2

Elf with White Cat Riding on a Leaf Stickers 2

these are lovely for your scrapbooking projects - to label items - or just envelope seals... © 2004-2015 MarloDee Designs (www.marlodeedesigns.com) : All rights reserved. Images on this site are not public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.8 out of 5 stars rating26.2K Total Reviews
22756 total 5-star reviews2162 total 4-star reviews509 total 3-star reviews290 total 2-star reviews436 total 1-star reviews
26,153 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nadine L.24 September 2023Verified Purchase
Zazzle Reviewer Program
Very high-quality labels that arrived on or before their stated date. Can not fault the workmanship I am very pleased with the labels and proud to use it on my product. The print was prefect, clear no blurring or smudges
5 out of 5 stars rating
By E.20 June 2025Verified Purchase
Great service, delivery was sooner than expected. ThankYou from New Zealand .
5 out of 5 stars rating
By J.7 August 2023Verified Purchase
Zazzle Reviewer Program
Stunning and eye catching product label, I be had lots of comments about how simple yet eye catching it is. Great, the green is perfect, the fonts are easy for people to read

Tags

Stickers
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful
All Products
fantasyfaefairyelfelveselvishmagicspellmother naturebeautiful

Other Info

Product ID: 217199683751234378
Posted on 11/10/2011, 1:03 PM
Rating: G