Tap / click on image to see more RealViewsTM
$6.00
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.5K Total Reviews
16452 total 5-star reviews719 total 4-star reviews127 total 3-star reviews65 total 2-star reviews137 total 1-star reviews
17,500 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kay C.31 October 2020Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This card was so lovely and my granddaughter opened the card and hugged it as it had a unicorn on the front and her name And I added a picture inside of us And when her mummy Asked her who it was from she said my nanny and grandad and hugged the card she can’t read yet but knew who it was from. ❤️. Excellent quality of printing colour
5 out of 5 stars rating
By Paul B.23 February 2026Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Fantastic quality and artwork - very pleased with this card. Will buy again from this creator. Paul - Australia .
5 out of 5 stars rating
By Clive C.1 February 2026Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
I use Zazzle every year to make a card for Chinese New Year. Superb service and great art work. Thank you for being here for me.

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Posted on 19/03/2019, 9:05 PM
Rating: G