Tap / click on image to see more RealViewsTM
$6.00
per card
 

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.00
+$1.00
-$0.30

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.2K Total Reviews
16214 total 5-star reviews707 total 4-star reviews121 total 3-star reviews61 total 2-star reviews120 total 1-star reviews
17,223 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kay C.31 October 2020Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This card was so lovely and my granddaughter opened the card and hugged it as it had a unicorn on the front and her name And I added a picture inside of us And when her mummy Asked her who it was from she said my nanny and grandad and hugged the card she can’t read yet but knew who it was from. ❤️. Excellent quality of printing colour
5 out of 5 stars rating
By Anonymous8 June 2025Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Great service - was sent out from UK to New Zealand then I posted it back to the UK. Good turn around and looked even better than I had expected. thanks. .
5 out of 5 stars rating
By A.26 September 2021Verified Purchase
Folded Greeting Card, Size: Big, 21.6 cm x 28 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
We downloaded several photos which was simple and produced a very attractive personalised card for our 11yr old Granddaughter. I was concerned that the card would not arrive on time but Zazzle came up trumps and the card arrived on the day before her birthday - perfect! I didn't see the card as it went straight to our family in New Zealand. However they did send a photo and it looked excellent!

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Posted on 19/03/2019, 9:05 PM
Rating: G