Tap / click on image to see more RealViewsTM
Sale Price $4.50.  
Original Price $6.00 per card
You save 25%

Fairy Circle by Arthur Rackham Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.30

Other designs from this category

About Folded Greeting Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Thank you, hello, or I love you, custom greeting cards are thoughtful gifts that are always the perfect way to express yourself.

  • Dimensions: 12.7 cm x 17.78 cm (portrait); 17.78 cm x 12.7 cm (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Fairy Circle by Arthur Rackham Card

Fairy Circle by Arthur Rackham Card

The fairies are celebrating. It is for A Midsummer Night's Dream. The colours are great. It is public domain.

Customer Reviews

4.9 out of 5 stars rating17.4K Total Reviews
16342 total 5-star reviews713 total 4-star reviews124 total 3-star reviews65 total 2-star reviews134 total 1-star reviews
17,378 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kay C.31 October 2020Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
This card was so lovely and my granddaughter opened the card and hugged it as it had a unicorn on the front and her name And I added a picture inside of us And when her mummy Asked her who it was from she said my nanny and grandad and hugged the card she can’t read yet but knew who it was from. ❤️. Excellent quality of printing colour
5 out of 5 stars rating
By Kaye G.14 December 2025Verified Purchase
Folded Greeting Card, Size: Standard, 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Great customer service and the cards were awesome… Could not find engagement cards in any stores so glad I came across your site.
5 out of 5 stars rating
By A.26 September 2021Verified Purchase
Folded Greeting Card, Size: Big, 21.6 cm x 28 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
We downloaded several photos which was simple and produced a very attractive personalised card for our 11yr old Granddaughter. I was concerned that the card would not arrive on time but Zazzle came up trumps and the card arrived on the day before her birthday - perfect! I didn't see the card as it went straight to our family in New Zealand. However they did send a photo and it looked excellent!

Tags

Folded Greeting Cards
fairiesfairyartarthurrackhamshakespearetreeplaywhite
All Products
fairiesfairyartarthurrackhamshakespearetreeplaywhite

Other Info

Product ID: 256603442933343167
Posted on 19/03/2019, 9:05 PM
Rating: G