Tap / click on image to see more RealViewsTM
$74.30
per round throw cushion
 

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Qty:
Personalise this template

Other designs from this category

About Round Cushions

Sold by

Size: Round Throw Cushion 41 x 41 cm

Zazzle cushions now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customisable cushions from Zazzle. Made from high-quality fabric, these soft cushions look great with your personalised designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 40.6 cm diameter (flat), 35.5 cm (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm (16" x 16"). For best results please add 1.9 cm (3/4") bleed..

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colours help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fiber
  • Machine washable, able to retain color and resist shrinkage

About This Design

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Royal Carriage Glass Slipper Pumpkin Round Cushion

Fairytale Princess theme feather topped carriage, slipper on a pillow & pumpkin motif in colours of ivory, blush pink and aqua blue.

Customer Reviews

4.7 out of 5 stars rating203 Total Reviews
163 total 5-star reviews25 total 4-star reviews7 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
203 Reviews
Reviews for similar products
5 out of 5 stars rating
By H.26 September 2021Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
Gorgeous printed named round cushion. Lovely gold swan with pink named cushion. Good quality sized print
5 out of 5 stars rating
By K.14 March 2021Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
I love that this product is different. To find a round cushion is not easy and the choices available were amazing! I have a piece of graffiti art and this goes perfect on a chair at my breakfast bar.
5 out of 5 stars rating
By M.11 December 2022Verified Purchase
Brushed Polyester Round Throw Cushion 41 x 41 cm
Zazzle Reviewer Program
Excellent quality product. Better than expected!

Tags

Round Cushions
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink
All Products
fairytalecarriagecoachpumpkinglass slipperfeminineelegantpastelgirlypink

Other Info

Product ID: 256120776374444500
Posted on 23/08/2020, 10:07 AM
Rating: G