Tap / click on image to see more RealViewsTM
$46.40
per pack of 100
 

Farmers Market Organic Fresh Eggs Chicken Business Card

Qty:
Squared
+$11.65
Signature Matte

17.5 pt thickness / 324 GSM weight
Light eggshell white, uncoated matte finish

+$11.10
+$11.10
+$11.10
+$22.15
+$22.15
+$22.15
+$22.15
+$22.15
+$22.15
+$41.95

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: American, 8.9 cm x 5.1 cm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 8.9 cm x 5.1 cm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

A classic, all around paper with a natural feel and an uncoated matte finish; our Standard Matte stands the test of time. Elegant and understated, colours print softer and more subtle.

  • 17.5 pt thickness / 324 GSM weight
  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating38K Total Reviews
31879 total 5-star reviews3774 total 4-star reviews932 total 3-star reviews558 total 2-star reviews807 total 1-star reviews
37,950 Reviews
Reviews for similar products
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 6.4 cm x 6.4 cm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend
5 out of 5 stars rating
By S M.27 May 2022Verified Purchase
Business Card, Size: Mini, 7.6 cm x 2.5 cm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
Very cute wee cards to attach to my products, customers adore them also. Spot On! Thank you so much
5 out of 5 stars rating
By L.10 October 2021Verified Purchase
Business Card, Size: American, 8.9 cm x 5.1 cm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
I was extreamly happy to receive this product. The quality of the printing is fantastic and arrive so fast! Perfect it got all the little details in my logo and looks fantastic

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Posted on 21/06/2024, 1:10 PM
Rating: G