Tap / click on image to see more RealViewsTM
$46.40
per pack of 100
 

Farmers Market Organic Fresh Eggs Chicken Business Card

Collection
Qty:
Squared
+$11.65
Signature Matte

17.5 pt thickness / 324 GSM weight
Light eggshell white, uncoated matte finish

+$11.10
+$11.10
+$11.10
+$22.15
+$22.15

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 89 mm x 51 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

A classic, all around paper with a natural feel and an uncoated matte finish; our Standard Matte stands the test of time. Elegant and understated, colours print softer and more subtle.

  • 17.5 pt thickness / 324 GSM weight
  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating38.7K Total Reviews
32389 total 5-star reviews3804 total 4-star reviews993 total 3-star reviews615 total 2-star reviews943 total 1-star reviews
38,744 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous4 February 2026Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Absolutely beautiful. Superior quality to Vistaprint, and the price made it very worth while. .
5 out of 5 stars rating
By Charlotte L.8 January 2023Verified Purchase
Business Card, Size: Square, 64 mm x 64 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I am stoked with these cards, the quality feels nice but also sustainable. Printing was great, my logo looks fantastic, I would highly recommend
5 out of 5 stars rating
By S M.27 May 2022Verified Purchase
Business Card, Size: Mini, 76 mm x 25 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
Very cute wee cards to attach to my products, customers adore them also. Spot On! Thank you so much

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Posted on 21/06/2024, 1:10 PM
Rating: G