Tap / click on image to see more RealViewsTM
$74.05
per tie
 

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm
      • Width: 10.1 cm (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    First Fibonacci Plaid Nerdy Math Tartan Tie

    First Fibonacci Plaid Nerdy Math Tartan Tie

    Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1818 total 5-star reviews325 total 4-star reviews144 total 3-star reviews73 total 2-star reviews117 total 1-star reviews
    2,477 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Libby L.14 July 2017Verified Purchase
    Tie
    Zazzle Reviewer Program
    Product was of good quality. The fabric is excellent
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Janette C.28 February 2016Verified Purchase
    Tie
    Zazzle Reviewer Program
    Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Libby L.14 July 2017Verified Purchase
    Tie
    Zazzle Reviewer Program
    Item is of very good quality. The fabric is excellent

    Tags

    Ties
    fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
    All Products
    fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

    Other Info

    Product ID: 151220032616911856
    Posted on 20/02/2016, 12:52 PM
    Rating: G