Sell on Zazzle
Tap / click on image to see more RealViewsTM
$55.70
per tie
 

First Fibonacci Plaid Nerdy Math Tartan Tie

4.5 out of 5 stars rating
2348 Total Reviews |
by
Qty:

Other designs from this category

About Ties

Sold by
Neck Tie
Create your own from scratch

Style: Tie

Upgrade your wardrobe with a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm
    • Width: 10.1 cm (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

First Fibonacci Plaid Nerdy Math Tartan Tie

First Fibonacci Plaid Nerdy Math Tartan Tie

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.
MWMarket
Artwork designed by
Beaverton, Oregon, United States
View their Store

Customer Reviews

4.5 out of 5 stars rating2.3K Total Reviews
1754 total 5-star reviews321 total 4-star reviews127 total 3-star reviews60 total 2-star reviews86 total 1-star reviews
2,348 Reviews
Reviews for similar products
5 out of 5 stars rating
By Libby L.14 July 2017 • Verified Purchase
Tie
Zazzle Reviewer Program
Product was of good quality. The fabric is excellent
5 out of 5 stars rating
By Janette C.28 February 2016 • Verified Purchase
Tie
Zazzle Reviewer Program
Beautiful material, and finish. Smart tie for a special birthday, my Dads 80th. Will look smashing with a nice suit. Printing excellent nice and clear.
5 out of 5 stars rating
By Libby L.14 July 2017 • Verified Purchase
Tie
Zazzle Reviewer Program
Item is of very good quality. The fabric is excellent

Tags

Ties
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 151220032616911856
Posted on 20/02/2016, 12:52 PM
Rating: G