Tap / click on image to see more RealViewsTM
$9.40
per sticker
 

Fun White Bride Groom Wedding Planner

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x10.16 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm L x 11.43 cm H
  • Design Area: 10.16 cm L x 10.16 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner

Fun White Bride Groom Wedding Planner sticker set

Customer Reviews

4.2 out of 5 stars rating190 Total Reviews
138 total 5-star reviews11 total 4-star reviews10 total 3-star reviews9 total 2-star reviews22 total 1-star reviews
190 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.5 May 2022Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
from zazzle.com (US)
5 out of 5 stars rating
By Nichole M.9 August 2020Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
from zazzle.com (US)
4 out of 5 stars rating
By Word S.10 December 2019Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Came out just as ordered, however the "3x3" inch size is misleading. The word I chose, "coffee", was smaller than my thumb nail. The outer area of the stickr was 3x3 as the description stated, but I don't think there was a way for me to know the actual sticker with the word would be SOOOO small. For future buyers - the sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space. The sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral
All Products
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral

Other Info

Product ID: 256170842373066873
Posted on 15/08/2022, 11:47 AM
Rating: G