Tap / click on image to see more RealViewsTM
$8.20
per bumper sticker
 

Funny Keep Honking Vinyl Bumper Sticker

Qty:

Other designs from this category

About Bumper Stickers

Sold by

Style: Bumper Sticker

Entertain the cars sitting behind you in traffic with a custom bumper sticker. Make your car a reflection of you and your personality, show off your particular politics, or brag about your honour roll child! Get your point across with this quality bumper sticker that will outlast heavy rain, intense sunlight, and the most severe of traffic jams.

  • Dimensions: 28 cm x 7.7 cm
  • Made from durable vinyl with a strong adhesive back that will hold up under the most severe of conditions
  • 100% weatherproof
  • Printed with water-resistant ink that won’t fade or run

About This Design

Funny Keep Honking Vinyl Bumper Sticker

Funny Keep Honking Vinyl Bumper Sticker

Add some sarcasm to your ride with our "Keep Honking, I Love Meaningless Feedback" vinyl bumper sticker – the perfect way to express your dry wit while stuck in traffic. This funny bumper sticker is ideal for drivers who appreciate a little roadside humour and aren’t afraid to show it. Crafted from durable, weatherproof vinyl, this high-quality car sticker is designed to withstand sun, rain, and whatever else the road throws at it. Whether you’re commuting, road-tripping, or just parked at the grocery store, this funny vinyl decal will definitely turn heads and spark a few chuckles. Perfect for: 🚗 Cars, trucks, and SUVs 💻 Laptops, water bottles, toolboxes 🎁 Gag gifts, stocking stuffers, or white elephant exchanges Product Features: Bold black & white design for maximum readability Easy peel-and-stick application Removable without residue Measures approx. 8" x 3" Show the world you’ve got a sense of humour (and a little bit of sass) with this hilarious bumper sticker. Because let’s face it—honking rarely helps, but sarcasm always does.

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3118 total 5-star reviews319 total 4-star reviews60 total 3-star reviews34 total 2-star reviews36 total 1-star reviews
3,567 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rose L.29 June 2021Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
I loved the words on this bumper sticker! I’m proud to stand up and confess Jesus as my Lord and Saviour, and vulnerable babies in the womb SHOULD be given the highest protection. Thank you for this wonderful declaration of faith and life. A friend saw mine and wanted one too, so I was happy to order another. Great! People notice it, that’s for sure. Love the colours…gorgeous.
5 out of 5 stars rating
By N.23 February 2021Verified Purchase
Bumper Sticker
Zazzle Reviewer Program
The sticker is larger than it looks just over 27cm long. But perfect, it will stand out and that is exactly what I needed! The printing is perfect.
5 out of 5 stars rating
By 1.8 April 2024Verified Purchase
Bumper Sticker
The flag of Myanmar is conspicuous on my car. Nobody recognises it, so it's raising awareness of the hideous plight of the people of Myanmar under the brutal military regime. First rate quality in all respects. Thank you

Tags

Bumper Stickers
funnybumperstickersarcasticcardecalvinylkeephonkingwitty
All Products
funnybumperstickersarcasticcardecalvinylkeephonkingwitty

Other Info

Product ID: 256615977567618302
Posted on 1/06/2025, 5:01 AM
Rating: G