Tap / click on image to see more RealViewsTM
$31.00
per shirt
 

Future Doctor Baby Bodysuit

Qty:
Personalise this template
Baby Jersey Bodysuit
+$10.40
+$10.40
-$4.15
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+$6.25
+$6.25
+$6.25
+$6.25

Other designs from this category

About T-Shirts

Sold by

Style: Baby Jersey Bodysuit

Not all baby bodysuits are created equal – this popular style is a must-have for your precious little bundle. The neckband is designed for easy on-and-off and a three-snap closure makes nappy changes easy peasy. Personalise it with a custom image or message or dress it up with a cute pair of socks and hat or hair accessory. There's no wrong way to wear this super soft bodysuit.

Size & Fit
  • Standard fit
  • Garment is unisex sizing
  • Flatlock seams, reinforced three snap closure
  • Fits true to size
Fabric & Care
  • 127.6 g (4.5 oz), 100% combed ring spun cotton (heather is 93/7) jersey
  • Double-needle ribbed binding on all openings
  • EasyTear™ label
  • White is sewn with 100% cotton thread
  • Machine washable. Washing before first use is recommended

Fully committed to providing high quality and safe products, all Zazzle baby products are Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available in side seam.

About This Design

Future Doctor Baby Bodysuit

Future Doctor Baby Bodysuit

Future Doctor with stethoscope motif. Nice gifts!

Customer Reviews

4.6 out of 5 stars rating2.5K Total Reviews
1909 total 5-star reviews404 total 4-star reviews100 total 3-star reviews45 total 2-star reviews37 total 1-star reviews
2,495 Reviews
Reviews for similar products
4 out of 5 stars rating
By P.22 July 2023Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
When I got the product it had a stain on it not happy as it is a gift for someone. Really good happy with it.
5 out of 5 stars rating
By Becky G.19 December 2022Verified Purchase
Baby Jersey Bodysuit, Black, 6 to 12 Month
Zazzle Reviewer Program
Very cute little suit, came extremely fast like a couple days! Great no issues with the printing
3 out of 5 stars rating
By M.6 August 2019Verified Purchase
Baby Jersey Bodysuit, White, 12 to 18 Month
Zazzle Reviewer Program
The product quality is good and the colour is even throughout. The press studs looks like good quality. The printing is not clear and is blurry, almost looks like an older washed items printing.

Tags

T-Shirts
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower
All Products
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower

Other Info

Product ID: 235157508766142999
Posted on 14/10/2021, 4:00 PM
Rating: G