Tap / click on image to see more RealViewsTM
$15.85
per set of 3 sheets
 

Garden Produce Wrapping Paper | Aprons & Tomatoes

4.8 out of 5 stars rating
1096 Total Reviews
|
by
Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customisable! Mix and match designs to create unique combinations
  • Dimensions: (3) 48 cm x 73 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

Garden Produce Wrapping Paper | Aprons & Tomatoes

Garden Produce Wrapping Paper | Aprons & Tomatoes

Garden Produce Wrapping Paper | Aprons & Tomatoes Fresh, charming, and full of farm-to-table personality. This kitchen-themed wrapping paper features my signature apron motif paired with vine-ripe tomatoes — the perfect choice for foodie gifts, homemade bakes, pantry presents, garden produce, and kitchen-lover celebrations. Ideal for: • food hampers, cooking gifts, teacher thank-yous • bakery boxes, kitchen accessories, home-grown produce • garden-to-table events, craft fairs, and boutique packaging • matching with the coordinating favour boxes, tags, and bags in my Garden to Table | Orchard & Produce Packaging collection Printed to order with worldwide shipping. Love this look? Follow my store thepapercraftstudio on Zazzle to see new releases — or simply add to cart now.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1001 total 5-star reviews48 total 4-star reviews19 total 3-star reviews4 total 2-star reviews24 total 1-star reviews
1,096 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nicky B.4 September 2025Verified Purchase
Extremely good quality wrapping - perfect for what I needed. .
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Fi S.24 March 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte
Zazzle Reviewer Program
So happy with the product. They warned it could be blurry on printing but I love it and there’s no blurriness at all. So good! It very clear :)
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.8 December 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte
Zazzle Reviewer Program
Love the design! Would 100% recommend it! Looks exactly as the pictures! Perfect! 😊

Tags

Wrapping Paper Sheet Sets
recipebookgiftwrapkitchenthemegiftwrapvegetableloversgiftwrappingtomato harvest gift wrappingfarmhouse kitchen packagingrecipe book gift wrappinggarden gift wrapfoodie birthday gift ideasboutique elegant gift wrapdeli kitchen gift wrap
All Products
recipebookgiftwrapkitchenthemegiftwrapvegetableloversgiftwrappingtomato harvest gift wrappingfarmhouse kitchen packagingrecipe book gift wrappinggarden gift wrapfoodie birthday gift ideasboutique elegant gift wrapdeli kitchen gift wrap

Other Info

Product ID: 256336844799673433
Posted on 16/01/2026, 2:32 AM
Rating: G